PDB entry 1exm

View 1exm on RCSB PDB site
Description: crystal structure of thermus thermophilus elongation factor tu (ef-tu) in complex with the GTP analogue gppnhp.
Class: translation
Keywords: gtpase, molecular switch, tRNA, ribosome, q-beta replicase, chaperone, disulfide isomerase, translation
Deposited on 2000-05-03, released 2000-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu (ef-tu)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1exma1, d1exma2, d1exma3
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1exmA (A:)
    akgefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    qmhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreever
    gqvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exmA (A:)
    gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerargit
    intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
    arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
    hrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgri
    ergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreevergq
    vlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemv
    mpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile