PDB entry 1exm

View 1exm on RCSB PDB site
Description: crystal structure of thermus thermophilus elongation factor tu (ef-tu) in complex with the gtp analogue gppnhp.
Deposited on 2000-05-03, released 2000-06-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-07, with a file datestamp of 2000-06-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1exmA (A:)
    gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerargit
    intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
    arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
    hrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgri
    ergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreevergq
    vlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemv
    mpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile