PDB entry 1exb

View 1exb on RCSB PDB site
Description: structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels
Deposited on 2000-05-02, released 2000-07-19
The last revision prior to the SCOP 1.57 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1exba_
  • Chain 'E':
    Domains in SCOP 1.57: d1exbe_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1exbA (A:)
    lqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagka
    evvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvv
    fanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqa
    eyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkd
    kilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmenig
    aiqvlpklsssivheidsilgnkpys
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1exbE (E:)
    cervvinisglrfetqlktlaqfpntllgnpkkrmryfdplrneyffdrnrpsfdailyy
    yqsggrlrrpvnvpldmfseeikfyelgeea