PDB entry 1ex0

View 1ex0 on RCSB PDB site
Description: human factor xiii, mutant w279f zymogen
Class: transferase
Keywords: TRANSGLUTAMINASE, BLOOD COAGULATION, mutant, W279F, oxyanion, TRANSFERASE
Deposited on 2000-04-28, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor xiii a chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00488
      • engineered (278)
      • conflict (508-509)
    Domains in SCOPe 2.07: d1ex0a1, d1ex0a2, d1ex0a3, d1ex0a4
  • Chain 'B':
    Compound: coagulation factor xiii a chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00488
      • conflict (34-35)
      • engineered (278)
      • conflict (508-510)
    Domains in SCOPe 2.07: d1ex0b1, d1ex0b2, d1ex0b3, d1ex0b4
  • Heterogens: CA, PO4, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ex0A (A:)
    setsrtafggrravppnnsnaaeddlptvelqgvnlrgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgsfdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntsrsmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ex0A (A:)
    afggrravppnnsnaaeddlptveqeflnvtsvhlfkerwdtnkvdhhtdkyennklivr
    rgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmr
    edrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavyldn
    ekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgnpik
    vsrvgsamvnakddegvlvgsfdniyaygvppsawtgsvdilleyrssenpvrygqcwvf
    agvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhcwne
    awmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfaevns
    dliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaleta
    lmygakkplntsrsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytg
    vpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakq
    kstvltipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkmfre
    irpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ex0B (B:)
    setsrtafggrravppnnsnaaeddlptvelqgvnlrgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgsfdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntsrsmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ex0B (B:)
    rtafggrravppnnsnaaeddlptvelqgvnlqeflnvtsvhlfkerwdtnkvdhhtdky
    ennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgk
    wgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwce
    ddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdl
    sgrgnpikvsrvgsamvnakddegvlvgsfdniyaygvppsawtgsvdilleyrssenpv
    rygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsv
    wnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdap
    fvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqee
    erlaletalmygakkplntsrsnvdmdfevenavlgkdfklsitfrnnshnrytitayls
    anitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarine
    trdvlakqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtr
    pmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqrrps