PDB entry 1ewy

View 1ewy on RCSB PDB site
Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
Deposited on 2000-04-28, released 2001-02-07
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-07, with a file datestamp of 2001-02-07.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.219
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewyA (A:)
    tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
    giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
    lthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpe
    yqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrv
    aehadelwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhv
    ety
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewyB (B:)
    tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
    giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
    lthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpe
    yqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrv
    aehadelwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhv
    ety
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewyC (C:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkeedly