PDB entry 1ewc

View 1ewc on RCSB PDB site
Description: crystal structure of zn2+ loaded staphylococcal enterotoxin h
Deposited on 2000-04-25, released 2000-05-31
The last revision prior to the SCOP 1.61 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.23
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewcA (A:)
    dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
    laqkfknknvdiygasfyykcekiseniseclyggttlnseklaqerviganvwvdgiqk
    etelirtnkknvtlqeldikirkilsdkykiyykdseiskgliefdmktprdysfdiydl
    ggendyeidkiyednktlksddishidvnlytkk