PDB entry 1ewa

View 1ewa on RCSB PDB site
Description: Dehaloperoxidase and 4-iodophenol
Class: oxidoreductase
Keywords: peroxidase, globin
Deposited on 2000-04-24, released 2000-05-10
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dehaloperoxidase
    Species: AMPHITRITE ORNATA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ewaa_
  • Chain 'B':
    Compound: dehaloperoxidase
    Species: AMPHITRITE ORNATA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ewab_
  • Heterogens: SO4, HEM, IOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewaA (A:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewaB (B:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk