PDB entry 1ew0

View 1ew0 on RCSB PDB site
Description: crystal structure analysis of the sensor domain of rmfixl(ferrous form)
Deposited on 2000-04-21, released 2000-05-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.205
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ew0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ew0A (A:)
    gshmletedvvrardahlrsildtvpdatvvsatdgtivsfnaaavrqfgyaeeevigqn
    lrilmpepyrhehdgylqrymatgekriigidrvvsgqrkdgstfpmklavgemrsgger
    fftgfirdlt