PDB entry 1evu

View 1evu on RCSB PDB site
Description: human factor xiii with calcium bound in the ion site
Class: transferase
Keywords: Transglutaminase, blood coagulation, calcium, TRANSFERASE
Deposited on 2000-04-20, released 2000-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.208
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor xiii
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00488 (0-End)
      • modified residue (0)
    Domains in SCOPe 2.07: d1evua1, d1evua2, d1evua3, d1evua4
  • Chain 'B':
    Compound: coagulation factor xiii
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evub1, d1evub2, d1evub3, d1evub4
  • Heterogens: CA, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1evuA (A:)
    setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evuA (A:)
    setsrtafggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyenn
    klivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwga
    kivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwcedda
    vyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgr
    gnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvryg
    qcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwny
    hcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvf
    aevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerl
    aletalmygakkplntsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitf
    ytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvl
    akqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkm
    freirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1evuB (B:)
    setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evuB (B:)
    fggrravppnnsnaaeddlptvelqgvvqeflnvtsvhlfkerwdtnkvdhhtdkyennk
    livrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgak
    ivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddav
    yldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrg
    npikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygq
    cwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyh
    cwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfa
    evnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerla
    letalmygakkplntrsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitf
    ytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvl
    akqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkm
    freirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr