PDB entry 1eve

View 1eve on RCSB PDB site
Description: three dimensional structure of the anti-alzheimer drug, e2020 (aricept), complexed with its target acetylcholinesterase
Class: serine hydrolase
Keywords: alzheimer's disease, drug, serine hydrolase, alpha/beta hydrolase, neurotransmitter cleavage, catalytic triad, glycosylated protein
Deposited on 1998-03-04, released 1999-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evea_
  • Heterogens: NAG, E20, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eveA (A:)
    ddhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwna
    stypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggf
    ysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwv
    hdniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvae
    grrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgef
    fptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsv
    phandlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyl
    yffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktg
    npnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnatacdge
    lss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eveA (A:)
    dhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnas
    typnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfy
    sgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvh
    dniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaeg
    rrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeff
    ptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvp
    handlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyly
    ffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgn
    pnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat