PDB entry 1ev9

View 1ev9 on RCSB PDB site
Description: rat glutathione s-transferase a1-1 mutant w21f with gso3 bound
Deposited on 2000-04-19, released 2001-02-07
The last revision prior to the SCOP 1.61 freeze date was dated 2001-02-07, with a file datestamp of 2001-02-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev9A (A:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieearkif
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev9C (C:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev9D (D:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieear