PDB entry 1ev4

View 1ev4 on RCSB PDB site
Description: rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound
Deposited on 2000-04-19, released 2001-02-07
The last revision prior to the SCOP 1.61 freeze date was dated 2001-02-07, with a file datestamp of 2001-02-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev4A (A:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieearkiykf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev4C (C:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev4D (D:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieearkiykf