PDB entry 1euz

View 1euz on RCSB PDB site
Description: glutamate dehydrogenase from thermococcus profundus in the unligated state
Deposited on 2000-04-19, released 2001-04-25
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-25, with a file datestamp of 2001-04-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.187
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euzA (A:)
    idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw
    argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl
    arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkplsigg
    slgrgtataqgaiftireaakalgidlkgkkiavqgygnagyytaklakeqlgmtvvavs
    dsrggiynpdgldpdevlkwkrehgsvkdfpgatnitneellelevdvlapaaieevite
    knadnikakivaevangpvtpeaddilrekgilqipdflcnaggvtvsyfewvqningyy
    wteeevrekldkkmtkafwevynthkdknihmrdaayvvavsrvyqamkdrgwvkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euzB (B:)
    idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw
    argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl
    arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkplsigg
    slgrgtataqgaiftireaakalgidlkgkkiavqgygnagyytaklakeqlgmtvvavs
    dsrggiynpdgldpdevlkwkrehgsvkdfpgatnitneellelevdvlapaaieevite
    knadnikakivaevangpvtpeaddilrekgilqipdflcnaggvtvsyfewvqningyy
    wteeevrekldkkmtkafwevynthkdknihmrdaayvvavsrvyqamkdrgwvkk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euzC (C:)
    idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw
    argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl
    arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkplsigg
    slgrgtataqgaiftireaakalgidlkgkkiavqgygnagyytaklakeqlgmtvvavs
    dsrggiynpdgldpdevlkwkrehgsvkdfpgatnitneellelevdvlapaaieevite
    knadnikakivaevangpvtpeaddilrekgilqipdflcnaggvtvsyfewvqningyy
    wteeevrekldkkmtkafwevynthkdknihmrdaayvvavsrvyqamkdrgwvkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euzD (D:)
    idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw
    argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl
    arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkplsigg
    slgrgtataqgaiftireaakalgidlkgkkiavqgygnagyytaklakeqlgmtvvavs
    dsrggiynpdgldpdevlkwkrehgsvkdfpgatnitneellelevdvlapaaieevite
    knadnikakivaevangpvtpeaddilrekgilqipdflcnaggvtvsyfewvqningyy
    wteeevrekldkkmtkafwevynthkdknihmrdaayvvavsrvyqamkdrgwvkk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euzE (E:)
    idpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhnw
    argptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqerl
    arayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkplsigg
    slgrgtataqgaiftireaakalgidlkgkkiavqgygnagyytaklakeqlgmtvvavs
    dsrggiynpdgldpdevlkwkrehgsvkdfpgatnitneellelevdvlapaaieevite
    knadnikakivaevangpvtpeaddilrekgilqipdflcnaggvtvsyfewvqningyy
    wteeevrekldkkmtkafwevynthkdknihmrdaayvvavsrvyqamkdrgwvkk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euzF (F:)
    eidpfemavkqleraaqymdiseealewlkkpmrivevsvpiemddgsvkvftgfrvqhn
    wargptkggirwhpaetlstvkalatwmtwkvavvdlpygggkggiivnpkelsereqer
    larayiravydvigpwtdipapdvytnpkimgwmmdeyetimrrkgpafgvitgkplsig
    gslgrgtataqgaiftireaakalgidlkgkkiavqgygnagyytaklakeqlgmtvvav
    sdsrggiynpdgldpdevlkwkrehgsvkdfpgatnitneellelevdvlapaaieevit
    eknadnikakivaevangpvtpeaddilrekgilqipdflcnaggvtvsyfewvqningy
    ywteeevrekldkkmtkafwevynthkdknihmrdaayvvavsrvyqamkdrgwvkk