PDB entry 1eut

View 1eut on RCSB PDB site
Description: sialidase, large 68kd form, complexed with galactose
Class: hydrolase
Keywords: hydrolase, glycosidase
Deposited on 1996-06-21, released 1997-01-11
The last revision prior to the SCOP 1.73 freeze date was dated 1997-01-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Micromonospora viridifaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1euta1, d1euta2, d1euta3
  • Heterogens: NA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eutA (A:)
    vppggeplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqr
    rstdggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgt
    dpadpnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrli
    qqytiinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsg
    yrkvavstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsr
    sqgtirmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg
    gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
    akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetare
    dgrasnvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvad
    yeiytslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaele
    vegqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eutA (A:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r