PDB entry 1eus

View 1eus on RCSB PDB site
Description: sialidase complexed with 2-deoxy-2,3-dehydro-n-acetylneuraminic acid
Deposited on 1996-06-21, released 1997-01-11
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.159
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1eus__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eus_ (-)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggi