PDB entry 1eum

View 1eum on RCSB PDB site
Description: crystal structure of the e.coli ferritin ecftna
Class: metal binding protein
Keywords: E.coli non heme Ferritin, EcFtnA, METAL BINDING PROTEIN
Deposited on 2000-04-17, released 2001-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.188
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1euma_
  • Chain 'B':
    Compound: ferritin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eumb_
  • Chain 'C':
    Compound: ferritin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eumc_
  • Chain 'D':
    Compound: ferritin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eumd_
  • Chain 'E':
    Compound: ferritin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eume_
  • Chain 'F':
    Compound: ferritin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eumf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eumA (A:)
    mlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eumA (A:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eumB (B:)
    mlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eumB (B:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eumC (C:)
    mlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eumC (C:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eumD (D:)
    mlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eumD (D:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstld
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1eumE (E:)
    mlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eumE (E:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstld
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1eumF (F:)
    mlkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdy
    ltdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnfl
    qwyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eumF (F:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstld