PDB entry 1euj

View 1euj on RCSB PDB site
Description: a novel anti-tumor cytokine contains a RNA-binding motif present in aminoacyl-tRNA synthetases
Class: cytokine
Keywords: EMAP 2, EMAP II, cytokine, tRNA synthetase, apoptosis, RNA binding motif
Deposited on 2000-04-17, released 2000-09-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothelial monocyte activating polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1euja_
  • Chain 'B':
    Compound: endothelial monocyte activating polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1eujb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eujA (A:)
    skpidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrm
    villcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnp
    kkkiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eujA (A:)
    pidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvi
    llcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkk
    kiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eujB (B:)
    skpidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrm
    villcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnp
    kkkiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eujB (B:)
    pidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvi
    llcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkk
    kiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik