PDB entry 1euj

View 1euj on RCSB PDB site
Description: a novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases
Deposited on 2000-04-17, released 2000-09-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-06, with a file datestamp of 2000-09-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1euja_
  • Chain 'B':
    Domains in SCOP 1.55: d1eujb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eujA (A:)
    pidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvi
    llcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkk
    kiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eujB (B:)
    pidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvi
    llcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkk
    kiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik