PDB entry 1eu3

View 1eu3 on RCSB PDB site
Description: crystal structure of the superantigen smez-2 (zinc bound) from streptococcus pyogenes
Deposited on 2000-04-13, released 2000-04-26
The last revision prior to the SCOP 1.61 freeze date was dated 2000-05-24, with a file datestamp of 2000-05-24.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.207
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eu3A (A:)
    glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
    fktgdkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpyn
    eistnkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtndnsdkysfdlfyvgy
    rdkesifkvykdnksfnidkighldieids
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eu3B (B:)
    evdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaandfk
    tgdkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpynei
    stnkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtndnsdkysfdlfyvgyrd
    kesifkvykdnksfnidkighldieids