PDB entry 1etz

View 1etz on RCSB PDB site
Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
Deposited on 2000-04-13, released 2000-10-18
The last revision prior to the SCOP 1.63 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzA (A:)
    favvtqesalttspgetvtltcrsstgavttsnyaiwvqekpdhlfsgliggtnnrvpgv
    parfsgsligdkaaltvtgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    ftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsraecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzB (B:)
    qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
    ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
    tltvssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfp
    allqsglytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzH (H:)
    qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
    ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
    tltvssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfp
    allqsglytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1etzL (L:)
    favvtqesalttspgetvtltcrsstgavttsnyaiwvqekpdhlfsgliggtnnrvpgv
    parfsgsligdkaaltvtgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    ftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsraecs