PDB entry 1etx

View 1etx on RCSB PDB site
Description: the crystal structure of e. coli fis mutant q74a
Deposited on 2000-04-13, released 2000-10-11
The last revision prior to the SCOP 1.67 freeze date was dated 2000-10-11, with a file datestamp of 2000-10-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.223
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1etxa_
  • Chain 'B':
    Domains in SCOP 1.67: d1etxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1etxA (A:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
    plldmvmqytrgnatraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etxA (A:)
    vltvkplrdsvkqalknyfaqlvndlyelvlaeveqplldmvmqytrgnatraalmmgin
    rgtlrkklkkygmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1etxB (B:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
    plldmvmqytrgnatraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etxB (B:)
    rvnsdvltvkplrdsvkqalknyfaqdvndlyelvlaeveqplldmvmqytrgnatraal
    mmginrgtlrkklkkygmn