PDB entry 1etw

View 1etw on RCSB PDB site
Description: the crystal structure of e. coli fis mutant g72d
Deposited on 2000-04-13, released 2000-10-11
The last revision prior to the SCOP 1.67 freeze date was dated 2000-10-11, with a file datestamp of 2000-10-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1etwa_
  • Chain 'B':
    Domains in SCOP 1.67: d1etwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1etwA (A:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
    plldmvmqytrdnqtraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etwA (A:)
    dvltvskplrdsvkqalknyfaqldvndlyelvlaeveqplldmvmqytrdnqtraalmm
    ginrgtlrkklkkygmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1etwB (B:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
    plldmvmqytrdnqtraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etwB (B:)
    rvnsdvltvstvnqvtqkplrdsvkqalknyfaqdvndlyelvlaeveqplldmvmqytr
    dnqtraalmmginrgtlrkklkkygmn