PDB entry 1etk

View 1etk on RCSB PDB site
Description: the crystal structure of e. coli fis mutant q68a
Deposited on 2000-04-13, released 2000-10-11
The last revision prior to the SCOP 1.67 freeze date was dated 2000-10-11, with a file datestamp of 2000-10-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.232
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1etka_
  • Chain 'B':
    Domains in SCOP 1.67: d1etkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1etkA (A:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
    plldmvmaytrgnqtraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etkA (A:)
    dvltvkplrdsvkqalknyfaqlvndlyelvlaeveqplldmvmaytrgnqtraalmmgi
    nrgtlrkklkkygmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1etkB (B:)
    mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
    plldmvmaytrgnqtraalmmginrgtlrkklkkygmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1etkB (B:)
    rvnsdvltvkplrdsvkqalknyfaqdvndlyelvlaeveqplldmvmaytrgnqtraal
    mmginrgtlrkklkkygmn