PDB entry 1etc

View 1etc on RCSB PDB site
Description: solution structure of the ets domain from murine ets-1: a winged helix-turn-helix DNA binding motif
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1995-03-22, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 1996-01-29, with a file datestamp of 2007-04-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: murine ets-1 transcription factor
    Species: MUS MUSCULUS
    Gene: ETS-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1etca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1etcA (A:)
gsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyekls
rglryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad

    Sequence, based on observed residues (ATOM records): (download) 
    >1etcA (A:)
iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr
yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkpdad