PDB entry 1et9

View 1et9 on RCSB PDB site
Description: crystal structure of the superantigen spe-h from streptococcus pyogenes
Class: immune system
Keywords: beta grasp, OB fold, superantigen fold
Deposited on 2000-04-12, released 2000-04-26
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superantigen spe-h
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1et9a1, d1et9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1et9A (A:)
    nsynttnrhnleslykhdsnlieadsiknspdivtshmlkysvkdknlsvffekdwisqe
    fkdkevdiyalsaqevcecpgkryeafggitltnsekkeikvpvnvwdkskqqppmfitv
    nkpkvtaqevdikvrkllikkydiynnreqkyskgtvtldlnsgkdivfdlyyfgngdfn
    smlkiysnneridstqfhvdvsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1et9A (A:)
    nsynttnrhnleslykhdsnlieadsiknspdivtshmlkysvknlsvffekdwisqefk
    dkevdiyalsaqeryeafggitltnsekkeikvpvnvwdkskqqppmfitvnkpkvtaqe
    vdikvrkllikkydiynnreqkyskgtvtldlnsgkdivfdlyyfgngdfnsmlkiysnn
    eridstqfhvdvsis