PDB entry 1et6

View 1et6 on RCSB PDB site
Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes
Class: immune system
Keywords: beta grasp, OB fold, superantigen fold, IMMUNE SYSTEM
Deposited on 2000-04-12, released 2000-05-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superantigen smez-2
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RQQ5 (1-209)
      • cloning artifact (1)
    Domains in SCOPe 2.05: d1et6a1, d1et6a2
  • Chain 'B':
    Compound: superantigen smez-2
    Species: Streptococcus pyogenes [TaxId:1314]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1et6b1, d1et6b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1et6A (A:)
    glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
    fktgdkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpyn
    eistnkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtndnsdkysfdlfyvgy
    rdkesifkvykdnksfnidkighldieids
    

    Sequence, based on observed residues (ATOM records): (download)
    >1et6A (A:)
    glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
    fktgdkiavfsvpfdwnylskgkvtaytyggitpyqpknipvnlwingkqisvpyneist
    nkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtkysfdlfyvgyrdkesifkv
    ykdnksfnidkighldieids
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1et6B (B:)
    glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
    fktgdkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpyn
    eistnkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtndnsdkysfdlfyvgy
    rdkesifkvykdnksfnidkighldieids
    

    Sequence, based on observed residues (ATOM records): (download)
    >1et6B (B:)
    dnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaandfktg
    dkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpyneist
    nkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtkysfdlfyvgyrdkesifkv
    ykdnksfnidkighldieids