PDB entry 1et6

View 1et6 on RCSB PDB site
Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes
Deposited on 2000-04-12, released 2000-05-10
The last revision prior to the SCOP 1.69 freeze date was dated 2000-05-24, with a file datestamp of 2000-05-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1et6A (A:)
    glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
    fktgdkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpyn
    eistnkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtndnsdkysfdlfyvgy
    rdkesifkvykdnksfnidkighldieids
    

    Sequence, based on observed residues (ATOM records): (download)
    >1et6A (A:)
    glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
    fktgdkiavfsvpfdwnylskgkvtaytyggitpyqpknipvnlwingkqisvpyneist
    nkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtkysfdlfyvgyrdkesifkv
    ykdnksfnidkighldieids
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1et6B (B:)
    glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
    fktgdkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpyn
    eistnkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtndnsdkysfdlfyvgy
    rdkesifkvykdnksfnidkighldieids
    

    Sequence, based on observed residues (ATOM records): (download)
    >1et6B (B:)
    dnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaandfktg
    dkiavfsvpfdwnylskgkvtaytyggitpyqktsipknipvnlwingkqisvpyneist
    nkttvtaqeidlkvrkfliaqhqlyssgssyksgrlvfhtkysfdlfyvgyrdkesifkv
    ykdnksfnidkighldieids