PDB entry 1est

View 1est on RCSB PDB site
Description: the atomic structure of crystalline porcine pancreatic elastase at 2.5 angstroms resolution. comparisons with the structure of alpha-chymotrypsin
Class: hydrolase
Keywords: hydrolase (serine proteinase), hydrolase
Deposited on 1976-05-17, released 1976-05-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: porcine pancreatic elastase
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00772 (0-239)
    • conflict (65)
  Domains in SCOPe 2.03: d1esta_
• Heterogens: SO4, TSU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1estA (A:)
  vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
  nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
  lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
  rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn