PDB entry 1esp

View 1esp on RCSB PDB site
Description: neutral protease mutant e144s
Deposited on 1995-08-11, released 1995-12-07
The last revision prior to the SCOP 1.57 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.178
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1esp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1esp_ (-)
    vtgtnkvgtgkgvlgdtkslnttlsgssyylqdntrgatiftydaknrstlpgtlwadad
    nvfnaaydaaavdahyyagktydyykatfnrnsindagaplkstvhygsnynnafwngsq
    mvygdgdgvtftslsggidvighslthavtenssnliyqnesgalneaisdifgtlvefy
    dnrnpdweigediytpgkagdalrsmsdptkygdpdhyskrytgssdnggvhtnsgiink
    qayllanggthygvtvtgigkdklgaiyyrantqyftqsttfsqaragavqaaadlygan
    saevaavkqsfsavgvn