PDB entry 1esf

View 1esf on RCSB PDB site
Description: staphylococcal enterotoxin a
Deposited on 1995-05-25, released 1996-07-11
The last revision prior to the SCOP 1.67 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1esfA (A:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esfA (A:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgffty
    ndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekk
    vpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrgli
    vfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1esfB (B:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1esfB (B:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgffyn
    dllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekkv
    pinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrgliv
    fhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts