PDB entry 1es0

View 1es0 on RCSB PDB site
Description:
Deposited on 2000-04-07, released 2000-06-28
The last revision prior to the SCOP 1.61 freeze date was dated 2000-06-28, with a file datestamp of 2000-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1es0a1, d1es0a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1es0b1, d1es0b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1es0A (A:)
    dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
    glqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhw
    ss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1es0B (B:)
    yeiapvfvlleyvtgsgsgsgdserhfvhqfkgecyftngtqrirlvtryiynreeylrf
    dsdvgeyravtelgrhsaeyynkqylertraeldtacrhnyeetevptslrrleqpnvai
    slsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvml
    emtphqgevytchvehpslkspitvews
    

    Sequence, based on observed residues (ATOM records): (download)
    >1es0B (B:)
    yeiapvfvlleyvtrhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyrav
    telgrhsaeyynkqylertraeldtacrhnyeetevptslrrleqpnvaislsntlvcsv
    tdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqgevytchvehps
    lkspitvews