PDB entry 1erw

View 1erw on RCSB PDB site
Description: human thioredoxin double mutant with cys 32 replaced by ser and cys 35 replaced by ser
Class: oxidoreductase
Keywords: dimer, oxidoreductase, thioredoxin, x-ray crystallography
Deposited on 1996-02-07, released 1996-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10599 (1-104)
    • engineered (31)
    • engineered (34)
  Domains in SCOPe 2.05: d1erwa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1erwA (A:)
  mvkqiesktafqealdaagdklvvvdfsatwsgpskmikpffhslsekysnviflevdvd
  dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv