PDB entry 1erv

View 1erv on RCSB PDB site
Description: human thioredoxin mutant with cys 73 replaced by ser (reduced form)
Class: oxidoreductase
Keywords: dimer, thioredoxin, x-ray crystallography, oxidoreductase
Deposited on 1996-02-07, released 1996-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.21
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (1-104)
      • engineered (72)
    Domains in SCOPe 2.06: d1erva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ervA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevksmptfqffkkgqkvgefsgankekleatinelv