PDB entry 1ert

View 1ert on RCSB PDB site
Description: human thioredoxin (reduced form)
Deposited on 1996-02-07, released 1996-10-14
The last revision prior to the SCOP 1.67 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1ert__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ert_ (-)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv