PDB entry 1err

View 1err on RCSB PDB site
Description: human estrogen receptor ligand-binding domain in complex with raloxifene
Class: nuclear receptor
Keywords: nuclear receptor, transcription factor, steroid, antagonist
Deposited on 1997-09-08, released 1998-09-16
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens
    Gene: ER ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1erra_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens
    Gene: ER ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1errb_
  • Heterogens: RAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1errA (A:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1errA (A:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvyeekdhihrvldkitdtlihlmakaglt
    lqqqhqrlaqlllilshirhmsnkgmehlysmplydlllemldah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1errB (B:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1errB (B:)
    lalsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlh
    dqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmllatss
    rfrmmnlqgeefvclksiillnsgvyleekdhihrvldkitdtlihlmakagltlqqqhq
    rlaqlllilshirhmsnkgmehlysmklydlllemldahrlha