PDB entry 1erq

View 1erq on RCSB PDB site
Description: x-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxy-2-hydroxyphenyl)ethyl boronic acid
Class: hydrolase
Keywords: beta-lactamase, structure-based design, boronate inhibitor, HYDROLASE
Deposited on 2000-04-06, released 2000-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tem-1 beta-lactamase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62593 (0-262)
  Domains in SCOPe 2.08: d1erqa_
• Heterogens: BJH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1erqA (A:)
  hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
  agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
  keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
  qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
  sqatmdernrqiaeigaslikhw