PDB entry 1ere

View 1ere on RCSB PDB site
Description: human estrogen receptor ligand-binding domain in complex with 17beta-estradiol
Class: nuclear receptor
Keywords: nuclear receptor, transcription factor, steroid, agonist
Deposited on 1997-09-08, released 1998-09-16
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.218
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ER ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1erea_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ER ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ereb_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ER ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1erec_
  • Chain 'D':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ER ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ered_
  • Chain 'E':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ER ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1eree_
  • Chain 'F':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ER ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1eref_
  • Heterogens: EST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ereA (A:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereA (A:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ereB (B:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereB (B:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ereC (C:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereC (C:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ereD (D:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereD (D:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ereE (E:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereE (E:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ereF (F:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ereF (F:)
    slalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr