PDB entry 1eqw

View 1eqw on RCSB PDB site
Description: crystal structure of salmonella typhimurium cu,zn superoxide dismutase
Class: oxidoreductase
Keywords: superoxide dismutase, Greek key b-barrel, OXIDOREDUCTASE
Deposited on 2000-04-06, released 2000-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cu,zn superoxide dismutase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53636 (0-End)
      • conflict (126)
    Domains in SCOPe 2.07: d1eqwa_
  • Chain 'B':
    Compound: cu,zn superoxide dismutase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53636 (0-155)
      • conflict (126)
    Domains in SCOPe 2.07: d1eqwb_
  • Chain 'C':
    Compound: cu,zn superoxide dismutase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53636 (0-End)
      • conflict (126)
    Domains in SCOPe 2.07: d1eqwc_
  • Chain 'D':
    Compound: cu,zn superoxide dismutase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53636 (0-End)
      • conflict (126)
    Domains in SCOPe 2.07: d1eqwd_
  • Heterogens: ZN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eqwA (A:)
    ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
    dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
    lkghslmihkggdnysdkpaplggggarfacgviek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqwA (A:)
    ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
    dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
    lkghslmihkggdnysdkpaplggggarfacgvie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqwB (B:)
    ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
    dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
    lkghslmihkggdnysdkpaplggggarfacgviek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eqwC (C:)
    ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
    dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
    lkghslmihkggdnysdkpaplggggarfacgviek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqwC (C:)
    ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
    dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
    lkghslmihkggdnysdkpaplggggarfacgvi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eqwD (D:)
    ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
    dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
    lkghslmihkggdnysdkpaplggggarfacgviek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqwD (D:)
    ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
    dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
    lkghslmihkggdnysdkpaplggggarfacgvi