PDB entry 1eq5

View 1eq5 on RCSB PDB site
Description: crystal structures of salt bridge mutants of human lysozyme
Class: hydrolase
Keywords: Salt bridge, stability
Deposited on 2000-04-03, released 2000-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2000-10-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (101)
    Domains in SCOP 1.73: d1eq5a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eq5A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrnpqgirawvawrnrcqnrd
    vrqyvqgcgv