PDB entry 1epw

View 1epw on RCSB PDB site
Description: crystal structure of clostridium neurotoxin type b
Class: hydrolase
Keywords: botulinum, zinc, metalloprotease, transmembrane, neurotoxin, HYDROLASE
Deposited on 2000-03-29, released 2000-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin type b
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1epwa1, d1epwa2, d1epwa3, d1epwa4
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1epwA (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
    iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqyl
    ysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndf
    vieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellip
    vvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmyk
    alnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvs
    ylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdls
    iytndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkl
    tssanskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsg
    wkisirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingk
    lesntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsys
    eylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyi
    gekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisds
    defyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcisk
    wylkevkrkpynlklgcnwqfipkdegwte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1epwA (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvgicidvdnedlffiadknsfsddlsknerieyntqsnyien
    dfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqylysq
    tfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndfvie
    anksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellipvvg
    afllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmykaln
    yqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvsylm
    kkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdlsiyt
    ndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkltss
    anskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsgwki
    sirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingkles
    ntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseyl
    kdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigek
    fiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisdsdef
    yntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfciskwyl
    kevkrkpynlklgcnwqfipkdegwte