PDB entry 1epw

View 1epw on RCSB PDB site
Description: crystal structure of clostridium neurotoxin type b
Deposited on 2000-03-29, released 2000-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1epwA (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
    iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqyl
    ysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndf
    vieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellip
    vvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmyk
    alnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvs
    ylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdls
    iytndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkl
    tssanskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsg
    wkisirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingk
    lesntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsys
    eylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyi
    gekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisds
    defyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcisk
    wylkevkrkpynlklgcnwqfipkdegwte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1epwA (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvgicidvdnedlffiadknsfsddlsknerieyntqsnyien
    dfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqylysq
    tfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndfvie
    anksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellipvvg
    afllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmykaln
    yqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvsylm
    kkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdlsiyt
    ndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkltss
    anskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsgwki
    sirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingkles
    ntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseyl
    kdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigek
    fiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisdsdef
    yntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfciskwyl
    kevkrkpynlklgcnwqfipkdegwte