PDB entry 1ept

View 1ept on RCSB PDB site
Description: refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin
Class: hydrolase (serine protease)
Keywords: hydrolase (serine protease)
Deposited on 1994-06-07, released 1995-02-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: porcine e-trypsin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00761 (0-42)
  Domains in SCOPe 2.03: d1ept.1
• Chain 'B':
  Compound: porcine e-trypsin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00761 (0-81)
  Domains in SCOPe 2.03: d1ept.1
• Chain 'C':
  Compound: porcine e-trypsin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00761 (0-97)
    • conflict (19)
    • conflict (41)
  Domains in SCOPe 2.03: d1ept.1
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eptA (A:)
  ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eptB (B:)
  sriqvrlgehnidvlegneqfinaakiithpnfngntldndimliklsspatlnsrvatv
  slprscaaagteclisgwgntk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eptC (C:)
  ssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggpvvcng
  qlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan