PDB entry 1ep8
View 1ep8 on RCSB PDB site
Description: crystal structure of a mutated thioredoxin, d30a, from chlamydomonas reinhardtii
Class: electron transport
Keywords: mutant, electron transport
Deposited on
2000-03-28, released
2001-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: thioredoxin ch1, h-type
Species: Chlamydomonas reinhardtii [TaxId:3055]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ep8a_ - Chain 'B':
Compound: thioredoxin ch1, h-type
Species: Chlamydomonas reinhardtii [TaxId:3055]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ep8b_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ep8A (A:)
ggsvividskaawdaqlakgkeehkpivvaftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ep8B (B:)
ggsvividskaawdaqlakgkeehkpivvaftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa