PDB entry 1ep8

View 1ep8 on RCSB PDB site
Description: crystal structure of a mutated thioredoxin, d30a, from chlamydomonas reinhardtii
Class: electron transport
Keywords: mutant, electron transport
Deposited on 2000-03-28, released 2001-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin ch1, h-type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80028 (0-111)
      • engineered (29)
    Domains in SCOPe 2.08: d1ep8a_
  • Chain 'B':
    Compound: thioredoxin ch1, h-type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80028 (0-111)
      • engineered (29)
    Domains in SCOPe 2.08: d1ep8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ep8A (A:)
    ggsvividskaawdaqlakgkeehkpivvaftatwcgpckmiaplfetlsndyagkvifl
    kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ep8B (B:)
    ggsvividskaawdaqlakgkeehkpivvaftatwcgpckmiaplfetlsndyagkvifl
    kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa