PDB entry 1ep7
View 1ep7 on RCSB PDB site
Description: crystal structure of wt thioredoxin h from chlamydomonas reinhardtii
Class: electron transport
Keywords: electron transport
Deposited on
2000-03-28, released
2001-12-12
The last revision prior to the SCOP 1.73 freeze date was dated
2003-09-30, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: thioredoxin ch1, h-type
Species: Chlamydomonas reinhardtii
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1ep7a_ - Chain 'B':
Compound: thioredoxin ch1, h-type
Species: Chlamydomonas reinhardtii
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1ep7b_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ep7A (A:)
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ep7B (B:)
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa