PDB entry 1ep7

View 1ep7 on RCSB PDB site
Description: crystal structure of wt thioredoxin h from chlamydomonas reinhardtii
Deposited on 2000-03-28, released 2001-12-12
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-30, with a file datestamp of 2003-09-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ep7a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ep7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ep7A (A:)
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ep7B (B:)
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa