PDB entry 1ep7

View 1ep7 on RCSB PDB site
Description: crystal structure of wt thioredoxin h from chlamydomonas reinhardtii
Class: electron transport
Keywords: electron transport
Deposited on 2000-03-28, released 2001-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin ch1, h-type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ep7a_
  • Chain 'B':
    Compound: thioredoxin ch1, h-type
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ep7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ep7A (A:)
    ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
    kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ep7B (B:)
    ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
    kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa