PDB entry 1ep5

View 1ep5 on RCSB PDB site
Description: crystal structure of the conserved core domain of venezualan equine encephalitis capsid protein
Deposited on 2000-03-27, released 2003-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ep5a_
  • Chain 'B':
    Domains in SCOP 1.65: d1ep5b_
  • Chain 'C':
    Domains in SCOP 1.65: d1ep5c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ep5A (A:)
    vmklesdktfpimlegkingyacvvggklfrpmhvegkidndvlaalktkkaskydleya
    dvpqnmradtfkythekpqgyyswhhgavqyengrftvpkgvgakgdsgrpildnqgrvv
    aivlggvnegsrtalsvvmwnekgvtvkytpenceqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ep5A (A:)
    mklesdktfpimlegkingyacvvggklfrpmhvegkidndvlaalktkkaskydleyad
    vpqnmradtfkythekpqgyyswhhgavqyengrftvpkgvgakgdsgrpildnqgrvva
    ivlggvnegsrtalsvvmwnekgvtvkytpenceqw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ep5B (B:)
    vmklesdktfpimlegkingyacvvggklfrpmhvegkidndvlaalktkkaskydleya
    dvpqnmradtfkythekpqgyyswhhgavqyengrftvpkgvgakgdsgrpildnqgrvv
    aivlggvnegsrtalsvvmwnekgvtvkytpenceqw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ep5C (C:)
    vmklesdktfpimlegkingyacvvggklfrpmhvegkidndvlaalktkkaskydleya
    dvpqnmradtfkythekpqgyyswhhgavqyengrftvpkgvgakgdsgrpildnqgrvv
    aivlggvnegsrtalsvvmwnekgvtvkytpenceqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ep5C (C:)
    sdktfpimlegkingyacvvggklfrpmhvegkidndvlaalktkkaskydleyadvpqn
    mradtfkythekpqgyyswhhgavqyengrftvpkgvgakgdsgrpildnqgrvvaivlg
    gvnegsrtalsvvmwnekgvtvkytpenceqw