PDB entry 1eoe

View 1eoe on RCSB PDB site
Description: crystal structure of the v135r mutant of a shaker t1 domain
Class: membrane protein
Keywords: potassium channels, aplysia kv1.1, proton transport, membrane protein
Deposited on 2000-03-22, released 2000-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.219
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: potassium channel kv1.1
  Species: Aplysia californica [TaxId:6500]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16968 (0-99)
    • engineered (69)
  Domains in SCOPe 2.07: d1eoea_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eoeA (A:)
  ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
  qsggrlrrprnvpldvfseeikfyelgenaferyredegf