PDB entry 1en7

View 1en7 on RCSB PDB site
Description: endonuclease vii (endovii) from phage t4
Deposited on 1999-02-07, released 2000-02-07
The last revision prior to the SCOP 1.59 freeze date was dated 2000-02-07, with a file datestamp of 2000-02-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1en7A (A:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1en7B (B:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk