PDB entry 1emw

View 1emw on RCSB PDB site
Description: solution structure of the ribosomal protein s16 from thermus thermophilus
Deposited on 2000-03-20, released 2000-08-09
The last revision prior to the SCOP 1.65 freeze date was dated 2000-08-09, with a file datestamp of 2000-08-09.
Experiment type: NMR47
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d1emwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1emwA (A:)
  mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
  svgaqptdtarrllrqagvfrqearega